PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0360749.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family BES1
Protein Properties Length: 324aa    MW: 34754.7 Da    PI: 8.2084
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0360749.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822214.72.2e-6621451150
           DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspessl 94 
                      ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g+sa  sp+ss+
  Lj0g3v0360749.1   2 TSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCKPVERMDVVGCSAAPSPCSSY 95 
                      5899****************************************************************************************** PP

           DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                      +        +sp++sy++sp sssfpsp s+  + + +   +sl+p+l++ls+ sss+
  Lj0g3v0360749.1  96 H--------PSPCASYNPSPGSSSFPSPRSSPYAVNPNGdgNSLIPWLKNLSSGSSSA 145
                      *........******************98876655444355**********9966654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.1E-663139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTSGTRQPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCKPVERM DVVGCSAAPS PCSSYHPSPC ASYNPSPGSS SFPSPRSSPY  120
AVNPNGDGNS LIPWLKNLSS GSSSASSSKL PQLFIHSGSI SAPVTPPLSS PTARTPRMQA  180
DWEDQSTRPG WGGQQYPFLP SSTPPSPGRQ VVDPDWFAGI RMPHGGPNSP TFSLVSSNPF  240
GFKDEVFVGS GSRMWTPGQS GTCSAAIAAG SDHTADIPMA EAVSDEFAFG SSTAGLVKPW  300
EGERIHEDCG SDDLELTLGS SKTR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.31470.0cell culture| flower| pod| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489004.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-136BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLG7IR051e-176G7IR05_MEDTR; Brassinazole-resistant 1 protein
STRINGVIT_19s0014g00870.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26613375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-112BES1/BZR1 homolog 4